PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.A00102.1.p
Common NameLOC105977021, MIMGU_mgv1a014924mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 183aa    MW: 20637.7 Da    PI: 7.0416
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.A00102.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.41.9e-30116174159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDg++WrKYG+K+vk+s++pr+YY+C+ +gC vkk+ver++ed+++v +tYeg Hnh+
  Migut.A00102.1.p 116 LDDGFKWRKYGKKMVKNSPNPRNYYKCSVEGCVVKKRVERDKEDQRYVLTTYEGIHNHQ 174
                       59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-31102174IPR003657WRKY domain
SuperFamilySSF1182903.14E-27108174IPR003657WRKY domain
PROSITE profilePS5081129.976111176IPR003657WRKY domain
SMARTSM007749.3E-34116175IPR003657WRKY domain
PfamPF031066.8E-23117174IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MQAQPDTKMS GASFGFHGSS SAGGHYSGQY TNFDVSDFFD FDQDFSSLIN PAGNYNDIPN  60
HDLEYCYTTN EVGLVDSTRV SSSSSSPEAM TINNRETKKE TRDKVAFRTK SEIEILDDGF  120
KWRKYGKKMV KNSPNPRNYY KCSVEGCVVK KRVERDKEDQ RYVLTTYEGI HNHQAAGSTF  180
RT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A4e-25106173774Probable WRKY transcription factor 4
1wj2_A4e-25106173774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012857735.11e-129PREDICTED: probable WRKY transcription factor 50
TrEMBLA0A022PV961e-129A0A022PV96_ERYGU; Uncharacterized protein
STRINGSolyc08g062490.2.12e-48(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21242462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.11e-40WRKY DNA-binding protein 50